PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00460.70
Common NameJCGZ_25629
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 252aa    MW: 28600.2 Da    PI: 9.6157
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00460.70genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.26e-26172221251
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                    +r+ Wt+eLH+rFv+a+e LGG+e AtPk+i+e+mk++gLt+++vkSHLQ
  Jcr4S00460.70 172 NRIIWTTELHSRFVDALEFLGGPEAATPKQIKEVMKLEGLTIDQVKSHLQ 221
                    799*********************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-21169221IPR009057Homeodomain-like
SuperFamilySSF466893.76E-14170228IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-23171222IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGSCTPSEMR LSLKTSGSYI PKSIANLLKE LSKIDSSSEK LTILNNFLKK HEEELSKVQL  60
FKNELPQCML LILDAIETLK EAVLNIKKGT GFEPGSDERG VMEFFAMKRR GYEIMQREIF  120
DPEEIKIQAV EEPEKSVGYG SLSVIRANDQ TLNFRAKQML LMPRGKPRGK NNRIIWTTEL  180
HSRFVDALEF LGGPEAATPK QIKEVMKLEG LTIDQVKSHL QVSALWMSEW KPTTIVKERP  240
GRLTFNTVGS RN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012088165.10.0PREDICTED: uncharacterized protein LOC105646840
TrEMBLA0A067JNG11e-179A0A067JNG1_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF148661012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13300.12e-17G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]